PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098999.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 150aa    MW: 16906.1 Da    PI: 8.0304
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098999.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.46.8e-4051041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dCv++pyfpa++p++fa+vhk++Gasnv k+lk+lp +++ +a++sl+yeA +r++dPvyG+vg+i+ l+qq+ +++ +la
  XP_011098999.1   5 RCAACKHLRRRCPSDCVFSPYFPANNPRRFAYVHKIYGASNVGKILKDLPVNRQAEAADSLYYEAYCRIKDPVYGCVGLITILHQQIYNAQCQLA 99 
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011098999.1 100 RIQAE 104
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.8014105IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MNSGRCAACK HLRRRCPSDC VFSPYFPANN PRRFAYVHKI YGASNVGKIL KDLPVNRQAE  60
AADSLYYEAY CRIKDPVYGC VGLITILHQQ IYNAQCQLAR IQAEIAALGT QSQSEVQQYQ  120
QVENVGPSFL PDQNGVPNST SYYDLSTWFD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098999.11e-110PREDICTED: LOB domain-containing protein 23-like
SwissprotP594673e-48LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A022QPJ35e-59A0A022QPJ3_ERYGU; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s13910.16e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.19e-49LOB domain-containing protein 24